Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRX1 P2LF1 U29[Gene ID: 1487906 ]
Triplex capsid protein 1
Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 6A> Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
MNSKSSARAAIVDTVEAVKKRKYISIDEGTLNNVVEKERKFLKQFLSGRQNLRIAARVFTPCELLAPELENLGMLMYRFETDVDNPKILFVGLFFLCSNA
FNVSTCVRTALTAMYTNSMVDNVLSMINTCRYLEDKVSLFGVTSLVSCGSSCLLSCVMQGNVYDVNKENIYGLTVLKEIILEPDWEPRQHSTQYVYVVHV
YKEVLAKLQYGIYVVLTSFQNEDLIVDILRQYFEKERFLFLNYLINSNTTLSYFGSVQRIGRCATEDIKSGFLQYRGITLSVIKLENIFVDLSEKKVFV
FNVSTCVRTALTAMYTNSMVDNVLSMINTCRYLEDKVSLFGVTSLVSCGSSCLLSCVMQGNVYDVNKENIYGLTVLKEIILEPDWEPRQHSTQYVYVVHV
YKEVLAKLQYGIYVVLTSFQNEDLIVDILRQYFEKERFLFLNYLINSNTTLSYFGSVQRIGRCATEDIKSGFLQYRGITLSVIKLENIFVDLSEKKVFV
299
Not Available
Not Available
01-10-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Structural component of the T=16 icosahedral capsid. The capsid is composed of pentamers and hexamers of major capsid protein/MCP, which are linked together by heterotrimers called triplexes. These triplexes are formed by a single molecule of triplex protein 1/TRX1 and two copies of triplex protein 2/TRX2. Additionally, TRX1 is required for efficient transport of TRX2 to the nucleus, which is the site of capsid assembly.
Not Available
Virion . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available