Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L1
Major capsid protein L1 (Fragment)
Human Papillomavirus Type 64
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Unclassified Papillomaviridae> Human Papillomavirus Types> Human Papillomavirus Type 64
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
AQGHNNGICWHNQLFLTVVYTTRSTNFSVCVGTQSTSTNPPYANTNFKEYLRHAEEYDLEFVFQLCKITLTTDVMTYIHSMSSSILEQWNFGLTPPPSGT
LEETYRYVTSQAITCQRPQPPKESEDPYAKMTFWEVDLKEKFSAELDQFPFGR
LEETYRYVTSQAITCQRPQPPKESEDPYAKMTFWEVDLKEKFSAELDQFPFGR
153
Not Available
Not Available
01-10-1996
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Forms an icosahedral capsid with a T=7 symmetry and about 55 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. The capsid encapsulates the genomic DNA, but does not bind DNA. Essential for the initial attachment to the host cell (By similarity).
Not Available
Virion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available