viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
PTP[Gene ID: 2715933 ]
♦Preterminal protein (pTP) (Bellett protein) (Precursor terminal protein) [Cleaved into: Intermediate terminal protein (iTP)
♦ Terminal protein (TP)]
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
Not Available
MALSVQDCARLTGQSVPAMERFSPLRNIWNRVREYARAATTAAGITWLSRYVYHYHRLMLEDLAPGTPATLRWPLYREPPPHFLVGYQYLVRTCNDYVFE
SRAYSRLRYTEITQPGMQVVNWSVMANCTYTINTGSYHRFVDLDDFQNTLTQIQQAVLAERVVADLALLQPLRGFGSTRMADRGELEIPVESLMQDYYKD
LRRCQNEAWGMADRLRIQQAGPKDVTLLATIRRLKTAYFNFLISSITSSAASLRIPHATVLSLPCDCDWLEAFLEKFSDPVQLDSLNEAWQSLPMQQMIR
CTVSALSLPQGPHLLPPLSGSGMQGGVFELRPRENGRAVTETMRRRRGEMIQRFIDRLPVRRRRRRQPVPAPVSPEGPAVEEEEFMEIEETPAAFEQEVR
ETVAEAIRLLQEELTFAARNSQFFNFAVDFYEAMDRLEALGDINEMTLRRWVMYFFVCEHIATTLNYLFQRLRNYAVFARHVELNIAQVVMRARNTVGDV
VYSRVWNENGLNAFSQLMRRISNDLAATVERAGHGELQDEEIDQFMSEIAYQDNSGDVQEILRQAAVNDADIDSVELSFRFRVRGPVVFSQRRHIQDLNR
RVVAYASQLRAQHQPLPELHADVPLPPLQANPHPPLPPDARPQRTM
646
Not Available
Not Available
01-02-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Protein covalently bound to the viral DNA that acts as a primer for viral genomic replication by DNA strand displacement. Assembles on the viral origin of replication in an initiation complex with viral polymerase, DBP, host NFIA and host POU2F1/OCT1. During initiation, the polymerase covalently couples the first dCTP with Ser-580 of pTP. The terminal protein stimulates the template activity over 20 fold compared to protein-free templates. Neo-synthesized viral genomes are linked to two preterminal proteins, one for each 5' end. These new genomes are encapsidated in the nucleus, and during capsid maturation by viral protease, preterminal protein is first cleaved into intermediary (iTP), then into mature TP. May play a role in host nuclear matrix localization of genomic DNA.
Not Available
GO:0003677  ;   GO:0006260  ;   GO:0039693  ;   GO:0044204  
Host nucleus matrix .
Not Available
MOTIF 357 366 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available