viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E7
Protein E7
Human Papillomavirus Type 25
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Betapapillomavirus> Betapapillomavirus 1> Human Papillomavirus Type 25
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MIGKEVTLQDFTLELSELQPEVQPVDLFCEEELPAEHQETEEEPAIDRTPYKVVAPCGCCEVKLRIFVKATDFGIRTLQNLLIEELQLLCPECRGNCKHG
GS
102
Not Available
Not Available
01-06-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Not Available
GO:0003677  ;   GO:0003700  ;   GO:0006351  ;   GO:0030430  ;   GO:0039502  ;  
GO:0039645  ;   GO:0042025  ;   GO:0046872  
Host cytoplasm . Host nucleus . Note=Predominantly found in the host nucleus. .
Not Available
MOTIF 27 31 LXCXE motif; interaction with host RB1 and TMEM173/STING. ; MOTIF 75 83 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available