viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A12L[Gene ID: 1486487 ]
25 kDa core protein A12L [Cleaved into: 17 kDa core protein A12L (17K)]
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MADKKNLAVRSSYDDYIETVNKITPQLKNLLAQIGGDAAVKGGNNNLNSQTDVTAGACDTKSKSSKCITCKSKSSSSSTSTSKSSKNTSGAPRRRTTATT
SFNAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIESVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPNDCCLDMGMY
189
Not Available
Not Available
01-02-1994
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the virion core that undergoes proteolytic processing during the immature virion (IV) to mature virion (MV) transition. Essential for the formation of a structurally normal core (By similarity).
Not Available
♦ 25 kDa core protein A12L: Virion . Note=Localizes to the virion core. .
♦ 17 kDa core protein A12L: Virion . Note=Localizes to the virion core. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available