Reviewed
Homo Sapiens (Human) [TaxID: 9606]
H3L I3L[Gene ID: 1486441 ]
Envelope protein H3 (Ag35) (Virion envelope protein p35)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MATVNKTPVIVVPVIDRPPSETFPNLHEHINDQKFDDVKDNEVMPEKRNVVIVKDDPDHYKDYAFIHWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIA
RHLALWDSKFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHVIFTYTGGYDVSLSAYIIRVTTALNIV
DEIIKSGGLSSGFYFEIARIENEIKINRQIMDNSAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAVKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFI
MFMLIFNVKSKLLWFLTGTFVTAFI
RHLALWDSKFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHVIFTYTGGYDVSLSAYIIRVTTALNIV
DEIIKSGGLSSGFYFEIARIENEIKINRQIMDNSAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAVKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFI
MFMLIFNVKSKLLWFLTGTFVTAFI
325
Not Available
Not Available
01-10-1993
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Envelope protein that binds to heparan sulfate on the cell surface and might provide virion attachment to target cell.
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Note=Component of the mature virion (MV) membrane. Becomes membrane associated presumably during virus maturation. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis (By similarity). .
♦ Single-pass membrane protein . Note=Component of the mature virion (MV) membrane. Becomes membrane associated presumably during virus maturation. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available