viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
G
Major surface glycoprotein G (Attachment glycoprotein G) (Membrane-bound glycoprotein) (mG)
Human Respiratory Syncytial Virus A (strain Rsb5857)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus A> Human Respiratory Syncytial Virus A (strain Rsb5857)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKTKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAIIFIASANHKVTLTTAIIQDATSQIKNTTQTYLTQNTQLGIS
FSNLSETTSQPTTTPALTTPSAKSTPQSTTVKTKNTTTTQIQPSKPTTKQRQKKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTT
KPTKKPTIKTTKKDLKPQTTKPKEVLTTKPTEKPTINTTRTNIRTTLLTTNTTGNPEYTSQKETLHSTSPEGNPSPSQVYTTSEYPSQPPSPSNTTN
297
VAR_SEQ 1 47 Missing (in isoform Secreted glycoprotein G)
Not Available
01-08-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (By similarity).
♦ Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.
Not Available
GO:0005576  ;   GO:0016021  ;   GO:0019062  ;   GO:0030683  ;   GO:0044228  ;  
GO:0046718  ;   GO:0055036  
♦ Virion membrane. Host cell surface .
♦ Isoform Secreted glycoprotein G: Secreted.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available