Reviewed
Aves [TaxID: 8782]; Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
PB2
Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) (Fragment)
Influenza A Virus (strain A/Camel/Mongolia/1982 H1N1)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H1N1 Subtype> Influenza A Virus (strain A/Camel/Mongolia/1982 H1N1)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
RITEMIPERNEQGQTLWSKMNDAGSDRVMVSPLAVTWWNRNGPITNTVHYPKIYKTYFERVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQD
VIMEVVFPNEVGARILTSESQLTITK
VIMEVVFPNEVGARILTSESQLTITK
126
Not Available
Not Available
01-05-1992
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays an essential role in transcription initiation and cap-stealing mechanism, in which cellular capped pre-mRNAs are used to generate primers for viral transcription. Binds the cap of the target pre-RNA which is subsequently cleaved after 10-13 nucleotides by PA. Plays a role in the initiation of the viral genome replication and modulates the activity of the ribonucleoprotein (RNP) complex. In addition, participates in the inhibition of type I interferon induction through interaction with the host mitochondrial antiviral signaling protein MAVS.
Not Available
GO:0003723 ; GO:0006370 ; GO:0019012 ; GO:0033650 ; GO:0039523 ;
GO:0039545 ; GO:0039694 ; GO:0042025 ; GO:0075526
GO:0039545 ; GO:0039694 ; GO:0042025 ; GO:0075526
Virion. Host nucleus . Host mitochondrion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available