Results | viHumans

UniProt ID

P21401

Status

Reviewed

Host

Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Bos Taurus X Bison Bison (beefalo) [TaxID: 297284]; Camelus Bactrianus (Bactrian Camel) [TaxID: 9837]; Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]

Gene Name

GP

Protein Name

♦Envelopment polyprotein (M polyprotein) [Cleaved into: NSm-Gn protein (p78 protein)
♦ Glycoprotein N (Gn) (Glycoprotein G1)
♦ Glycoprotein C (Gc) (Glycoprotein G2)]

Organism Name

Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)

Taxonomic Lineage

Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Phenuiviridae> Phlebovirus> Rift Valley Fever Phlebovirus> Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)

RefSeq

NC_014397.1 ; DQ375403.1 ; NC_014396.1 ; DQ375403.1 ; NC_014395.1 ; DQ380151.1

PubMed ID

2705307 ; 3046119 ; 2728348 ; 12414959 ; 16963099 ; 18715915 ; 21445316 ; 21767814 ; 22710362 ;
23097454 ; 26038497 ; 24489907

Pathways Involved

Various pathway(s) in which protein is involved

KEGG

Not Available

Reactome

Not Available

Sequence

							MYVLLTILTSVLVCEAIIRVSLSSTREETCFGDSTNPEMIEGAWDSLREEEMPEELSCSISGIREVKTSSQELYRALKAIIAADGLNNITCHGKDPEDKI
SLIKGPPHKKRVGIVRCERRRDAKQIGRKTMAGIAMTVLPALAVFALAPVVFAEDPHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKF
PLFQSYAHHRTLLEAVHDTIIAKADPPSCDLLSAHGNPCMKEKLVMKTHCPNDYQSAHHLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQ
DLFCQSSEDDGSKLKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTMDSGQTKRELKSFDIS
QCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKI
SSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQSVSSKIVAHCPPQDPCLVHDCIVCAHGLINYQCHTALSAFVVVFVFSSIAIICL
AILYRVLKCLKIAPRKVLNPLMWITAFIRWIYKKMVARVADNINQVNREIGWMEGGQLVLGNPAPIPRHAPIPRYSTYLMLLLIVSYASACSELIQASSR
ITTCSTEGVNTKCRLSGTALIRAGSVGAEACLMLKGVKEDQTKFLKLKTVSSELSCREGQSYWTGSFSPKCLSSRRCHLVGECHVNRCLSWRDNETSAEF
SFVGESTTMRENKCFEQCGGWGCGCFNVNPSCLFVHTYLQSVRKEALRVFNCIDWVHKLTLEITDFDGSVSTIDLGASSSRFTNWGSVSLSLDAEGISGS
NSFSFIESPGKGYAIVDEPFSEIPRQGFLGEIRCNSESSVLSAHESCLRAPNLISYKPMIDQLECTTNLIDPFVVFERGSLPQTRNDKTFAASKGNRGVQ
AFSKGSVQADLTLMFDNFEVDFVGAAVSCDAAFLNLTGCYSCNAGARVCLSITSTGTGSLSAHNKDGSLHIVLPSENGTKDQCQILHFTVPEVEEEFMYS
CDGDERPLLVKGTLIAIDPFDDRREAGGESTVVNPKSGSWNFFDWFSGLMSWFGGPLKTILLICLYVALSIGLFFLLIYLGGTGLSKMWLAATKKAS
						

Length

1197

Alternate Sequence

VAR_SEQ 1 51 Missing (in isoform NSm' protein) ; VAR_SEQ 1 38 Missing (in isoform NSm protein) ; VAR_SEQ 154 1197 Missing (in isoform NSm protein and isoform NSm' protein)

Non-standard residue

Not Available

Date of last Sequence modification

01-05-1991

Protein Existence

Evidence at protein level

Amino Acid composition

Amino Acid	Count	% Frequency	Amino Acid	Count	% Frequency
Alanine (A)			Leucine (L)
Arginine (R)			Lysine (K)
Asparagine (N)			Methionine (M)
Aspartic Acid (D)			Phenylalanine (F)
Cysteine (C)			Proline (P)
Glutamine (Q)			Serine (S)
Glutamic Acid (E)			Threonine (T)
Glycine (G)			Tryptophan (W)
Histidine (H)			Tyrosine (Y)
Isoleucine (I)			Valine (V)

Sum of Absolute Deviation from Amino Acid Occurrence Frequencies

Aliphatic Index

Instability Index

Secondary Structure features

% Number of Residues in Helices	% Number of Residues in Strands	% Number of Residues in Coils

Structural Difficulty(SD) index

Role(s)

♦Glycoprotein N: Structural component of the virion that interacts with glycoprotein N. About 720 Gn and 720 Gc proteins form 12 pentameric and 110 hexameric capsomeres. Theses capsomeres are arranged on the virus envelop surface in an icosahedral lattice with a T=12 quasisymmetry. Attaches the virion to a cell receptor and thereby promotes fusion after endocytosis of the virion. Contains a Golgi retention signal on its C-terminal region and brings Gc to the host Golgi apparatus where assembly occurs.
♦ Glycoprotein C: Structural component of the virion that interacts with glycoprotein C. About 720 Gn and 720 Gc proteins form 12 pentameric and 110 hexameric capsomeres. Theses capsomeres are arranged on the virus envelop surface in an icosahedral lattice with a T=12 quasisymmetry. Attaches the virion to a cell receptor and thereby promotes fusion after endocytosis of the virion.
♦ Isoform NSm protein: Plays a role in the inhibition of virus-induced apoptosis. Plays a role for virus dissemination in vertebrates.
♦ NSm-Gn protein: Plays a role for virus dissemination in mosquitoes. May act as a strucutral virion protein in insects.

EC

Not Available

Experimentally known GO terms

GO:0016021 ;   GO:0019012 ;   GO:0019050 ;   GO:0019062 ;   GO:0019068 ;
GO:0039526 ;   GO:0039654 ;   GO:0044167 ;   GO:0044178 ;   GO:0044193 ;
GO:0046760 ;   GO:0055036

Subcellular Location

♦ Glycoprotein N: Virion membrane
♦ Single-pass type I membrane protein . Host Golgi apparatus membrane ,
♦ Single-pass type I membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein .
♦ Glycoprotein C: Virion membrane
♦ Single-pass type I membrane protein . Host Golgi apparatus membrane
♦ Single-pass type I membrane protein . Note=Interaction between Gn and Gc is essential for proper targeting of GC to the Golgi complex, where virion budding occurs. .
♦ Isoform NSm protein: Host mitochondrion outer membrane .
♦ NSm-Gn protein: Host Golgi apparatus . Virion . Note=Localizes in virions maturing in cells of insect origin but not in cells of mammalian origin. .

Domain(s)

Not Available

Motif(s)

Not Available

Methods of 3D structure generation

Electron microscopy (3)

Experimetally known structure

6F9C 6F9D 6F9E

Active Site(s)

Not Available

Predicted 3D Structures

Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.

Experimentally known Ligand(s)

Not Available

Virtually Screened Ligands

Virtual screening has been performed using RASPD

						Million Molecules

					
Best 20 Hit molecules 
Not Available