Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NB
Glycoprotein NB
Influenza B Virus (strain B/Victoria/3/1985)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Betainfluenzavirus> Influenza B Virus> Influenza B Virus (strain B/Victoria/3/1985)
NC_002205.1 ; AF102017.1 ; NC_002206.1 ; AF102017.1 ; NC_002207.1 ; M14880.1 ; NC_002208.1 ;
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
Various pathway(s) in which protein is involved
Not Available
Not Available
MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFTKNNCTNNDIGLHERIKCSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN
99
Not Available
Not Available
01-04-1990
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Putative viral proton channel. May play a role in virus entry (By similarity).
Not Available
♦ Virion membrane
♦ Single-pass type III membrane protein .
♦ Single-pass type III membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available