Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Pre-early 3 receptor internalization and degradation alpha protein (Pre-E3-RID-alpha protein) [Cleaved into: Early 3 receptor internalization and degradation alpha protein (E3-RID-alpha protein) (Pre-Early E3B 10.4 kDa protein)]
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MIPRVLILLTLVALFCACSTLAAVAHIEVDCIPPFTVYLLYGFVTLILICSLVTVVIAFIQFIDWVCVRIAYLRHHPQYRDRTIADLLRIL
91
Not Available
Not Available
01-04-1990
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Prevents infected cell apoptosis induced by the host immune system. Acts by down-regulating a number of cell surface receptors in the tumor necrosis factor (TNF) receptor superfamily, namely FAS, TNFRSF10A/TRAIL receptor 1, and TNFRSF10B/TRAIL receptor 2. Down-regulation of these death receptors protects adenovirus-infected cells from apoptosis induced by the death receptor ligands Fas ligand and TRAIL. RID complex also down-regulates certain tyrosine kinase cell surface receptors, especially the epidermal growth factor receptor (EGFR). RID-mediated Fas and EGFR down-regulation occurs via endocytosis of the receptors into endosomes followed by transport to and degradation within lysosomes.
Not Available
♦ Pre-early 3 receptor internalization and degradation alpha protein: Host membrane
♦ Multi-pass membrane protein. Host endoplasmic reticulum.
♦ Early 3 receptor internalization and degradation alpha protein: Host membrane
♦ Single-pass type I membrane protein. Host endoplasmic reticulum.
♦ Multi-pass membrane protein. Host endoplasmic reticulum.
♦ Early 3 receptor internalization and degradation alpha protein: Host membrane
♦ Single-pass type I membrane protein. Host endoplasmic reticulum.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available