viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag
♦Gag polyprotein (Pr71Gag) [Cleaved into: Gag protein (p68Gag)
♦ p3 (p3Gag)]
Human Spumaretrovirus (SFVcpz(hu)) (Human Foamy Virus)
Viruses> Retro-transcribing Viruses> Retroviridae> Spumaretrovirinae> Spumavirus> Simian Foamy Virus> Human Spumaretrovirus (SFVcpz(hu)) (Human Foamy Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MASGSNVEEYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQDDDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDL
DLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSSTGQGGISPGAPRSRPPVSSF
SGLPSLPSIPGIHPRAPSPPRATSTPGNIPWSLGDDSPPSSSFPGPSQPRVSFHPGNPFVEEEGHRPRSQSRERRREILPAPVPSAPPMIQYIPVPPPPP
IGTVIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVD
QEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDNQTRAETFIQHLNAVYEILGLNARGQSIRASVTPQPRPSRGRGRGQNTSRPS
QGPANSGRGRQRPASGQSNRGSSTQNQNQDNLNQGGYNLRPRTYQPQRYGGGRGRRWNDNTNNQESRPSDQGSQTPRPNQAGSGVRGNQSQTPRPAAGRG
GRGNHNRNQRSSGAGDSRAVNTVTQSATSSTDESSSAVTAASGGDQRD
648
Not Available
Not Available
11-07-2006
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Involved in capsid formation and genome binding. Shortly after infection, interaction between incoming particle-associated Gag proteins and host dynein allows centrosomal targeting of the viral genome (associated to Gag), prior to nucleus translocation and integration into host genome.
Not Available
GO:0003677  ;   GO:0003723  ;   GO:0019013  ;   GO:0019076  ;   GO:0030430  ;  
GO:0039702  ;   GO:0042025  ;   GO:0044163  ;   GO:0046718  ;   GO:0075521  
♦ Gag protein: Virion. Host nucleus. Host cytoplasm. Note=Nuclear at initial phase, cytoplasmic at assembly. Shortly after infection, Gag protein is targeted to centrosomes. It is then actively transported into the nucleus thanks to its nuclear localization signal. In the late phases of infection, Gag proteins assemble in the cytoplasm to form the virion's capsids.
♦ p3: Virion.
Not Available
MOTIF 284 287 PTAP/PSAP motif.; MOTIF 535 556 Nuclear localization signal.
X-ray crystallography (3); NMR spectroscopy (2)
4JMR  4JNH  5M1G  5M1H  5MLU  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available