Results | viHumans

UniProt ID

P12936

Status

Reviewed

Host

Homo Sapiens (Human) [TaxID: 9606]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]

Gene Name

X

Protein Name

Protein X (HBx) (Peptide X) (pX)

Organism Name

Hepatitis B Virus Genotype C Subtype Adr (strain Japan/adr4/1983) (HBV-C)

Taxonomic Lineage

Viruses> Retro-transcribing Viruses> Hepadnaviridae> Orthohepadnavirus (mammalian Hepatitis B-type Viruses)> Hepatitis B Virus (HBV)> Hepatitis B Virus Subtype Adr (HBV)> Hepatitis B Virus Genotype C Subtype Adr (strain Japan/adr4/1983) (HBV-C)

RefSeq

NC_003977.2 ; V01460.1

PubMed ID

6306594 ; 15542625 ; 16984372

Pathways Involved

Various pathway(s) in which protein is involved

KEGG

Not Available

Reactome

Not Available

Sequence

							MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLFVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
						

Length

154

Alternate Sequence

Not Available

Non-standard residue

Not Available

Date of last Sequence modification

01-10-1989

Protein Existence

Inferred from homology

Amino Acid composition

Amino Acid	Count	% Frequency	Amino Acid	Count	% Frequency
Alanine (A)			Leucine (L)
Arginine (R)			Lysine (K)
Asparagine (N)			Methionine (M)
Aspartic Acid (D)			Phenylalanine (F)
Cysteine (C)			Proline (P)
Glutamine (Q)			Serine (S)
Glutamic Acid (E)			Threonine (T)
Glycine (G)			Tryptophan (W)
Histidine (H)			Tyrosine (Y)
Isoleucine (I)			Valine (V)

Sum of Absolute Deviation from Amino Acid Occurrence Frequencies

Aliphatic Index

Instability Index

Secondary Structure features

% Number of Residues in Helices	% Number of Residues in Strands	% Number of Residues in Coils

Structural Difficulty(SD) index

Role(s)

Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC). Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT.

EC

Not Available

Experimentally known GO terms

GO:0006351 ; GO:0006355 ; GO:0019079 ; GO:0033650 ; GO:0039592 ;
GO:0039652 ; GO:0042025

Subcellular Location

Host cytoplasm . Host nucleus . Host mitochondrion . Note=Mainly cytoplasmic as only a fraction is detected in the nucleus. In cytoplasm, a minor fraction associates with mitochondria or proteasomes. .

Domain(s)

Not Available

Motif(s)

Not Available

Methods of 3D structure generation

Predicted/Modelled

Experimetally known structure

Not Available

Active Site(s)

Not Available

Predicted 3D Structures

Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.

Experimentally known Ligand(s)

Not Available

Virtually Screened Ligands

Virtual screening has been performed using RASPD

						Million Molecules

					
Best 20 Hit molecules 
Not Available