Reviewed
Homo Sapiens (Human) [TaxID: 9606]
HBZ
HTLV-1 basic zipper factor (HBZ)
Human T-cell Leukemia Virus 1 (isolate Melanesia Mel5 Subtype C) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype C> Human T-cell Leukemia Virus 1 (isolate Melanesia Mel5 Subtype C) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MINFVFVGPFRCLPVPCPEDLLVEDLVDGLLSLEDELKDQREEEESVLDGVLSLEEESRLRWGPVGEEAPPRGETHRDRQRRAEEKRKRKREREKEEEKQ
IAEFLKRKREKEAWRRRRAEEKAADRARRKLEEEERRERKWRQTEQGAKQRSARKEKMTELGVDGYARQLESEAESLEAERGRLLQENDDLMGEVNYWQR
RLEAMWSQ
IAEFLKRKREKEAWRRRRAEEKAADRARRKLEEEERRERKWRQTEQGAKQRSARKEKMTELGVDGYARQLESEAESLEAERGRLLQENDDLMGEVNYWQR
RLEAMWSQ
208
VAR_SEQ 1 7 MINFVFV -> MAAS (in isoform HBZ-SI)
Not Available
28-07-2009
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Contributes to the regulation of viral RNA transcription by interacting with host proteins involved in transcriptional activation such as ATF4, or CREB1, and by inhibiting their activity. Additionally, HBZ suppresses host NF-kappa-B-driven transcription mediated by host RELA as well as transcription of some classical NF-kappa-B target genes, including IL8, IL2RA, IRF4, VCAM1, and VEGFA (By similarity).
Not Available
Host nucleus .
Not Available
MOTIF 86 91 Nuclear localization signal 1. ; MOTIF 115 119 Nuclear localization signal 2. ; MOTIF 136 140 Nuclear localization signal 3.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available