viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRM3 BGRF1/BDRF1[Gene ID: 3783767;5176176 ]
Tripartite terminase subunit 3 (EC 3.1.-.-) (Terminase large subunit)
Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain AG876) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MLYASQRGRLTENLRNALQQDSTTQGCLGAETPSIMYTGAKSDRWAHPLVGTIHASNLYCPMLRAYCRHYGPRPVFVASDESLPMFGASPALHTPVQVQM
CLLPELRDTLQRLLPPPNLEDSEALTEFKTSVSSARAILEDPNFLEMREFVTSLASFLSGQYKHKPARLEAFQKQVVLHSFYFLISIKSLEITDTMFDIF
QSAFGLEEMTLEKLHIFKQKASVFLIPRRHGKTWIVVAIISLILSNLSNVQIGYVAHQKHVASAVFTEIIDTLTKSFDSKRVEVNKETSTITFRHSGKIS
STVMCATCFNKNSIRGQTFHLLFVDEANFIKKEALPAILGFMLQKDAKIIFISSVNSADQATSFLYKLKDAQERLLNVVSYVCQEHRQDFDMQDSMVSCP
CFRLHIPSYITMDSNIRATTNLFLDGAFSTELMGDTSSLSQGSLSRTVRDDAINQLELCRVDTLNPRVAGRLASSLYVYVDPAYTNNTSASGTGIAAVTH
DRADPNRVIVLGLEHFFLKDLTGDAALQIATCVVALVSSIVTLHPHLEEVKVAVEGNSSQDSAVAIASIIGESCPLPCAFVHTKDKTSSLQWPMYLLTNE
KSKAFERLIYAVNTASLSASQVTVSNTIQLSFDPVLYLISQIRAIKPIPLRDGTYTYTGKQRNLSDDVLVALVMAHFLATTQKHTFKKVH
690
Not Available
Not Available
28-07-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM2 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid. TRM3 carries an RNase H-like nuclease activity that plays an important role for the cleavage of concatemeric viral DNA into unit length genomes.
3.1.-.-  
GO:0003677  ;   GO:0006323  ;   GO:0016787  ;   GO:0042025  
Host nucleus . Note=Responsible for the nuclear localization of the two others subunits TRM1 and TRM2. .
Not Available
MOTIF 226 233 Walker A motif. ; MOTIF 321 326 Walker B motif.
Predicted/Modelled
Not Available
♦ACT_SITE 326 326 For ATPase activity.
♦ ACT_SITE 481 481 For nuclease activity.
♦ ACT_SITE 555 555 For nuclease activity.
♦ ACT_SITE 667 667 For nuclease activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available