Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF46
Tegument protein UL14 homolog
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSGHTPTYASHRRNRVKLVEAHNRAGLFKERTLDLIRGGASVQDPAFVYAFTAAKEACADLNNQLRSAARIASVEQKIRDIQSKVEEQTSIQQILNTNRR
YIAPDFIRGLDKTEDDNTDNIDRLEDAVGPNIEHENHTWFGEDDEALLTQWMLTTHPPTSKYLQLQDLCVPTTIPTDMNQMQPQPISKNENPPTPHTDV
YIAPDFIRGLDKTEDDNTDNIDRLEDAVGPNIEHENHTWFGEDDEALLTQWMLTTHPPTSKYLQLQDLCVPTTIPTDMNQMQPQPISKNENPPTPHTDV
199
Not Available
Not Available
01-07-1989
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Contributes to the nuclear transport of the viral transcriptional activator VP16 homolog during the early phase of infection. Therefore, participates indirectly in the regulation of the immediate-early gene expression. Additionally, seems to be important for efficient nuclear targeting of capsids (By similarity).
Not Available
Virion tegument . Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available