viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E6[Gene ID: 1489169 ]
Protein E6
Human Papillomavirus Type 1 (Human Papillomavirus Type 1a)
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Mupapillomavirus> Mupapillomavirus 1> Human Papillomavirus Type 1 (Human Papillomavirus Type 1a)
Various pathway(s) in which protein is involved
Not Available
MATPIRTVRQLSESLCIPYIDVLLPCNFCNYFLSNAEKLLFDHFDLHLVWRDNLVFGCCQGCARTVSLLEFVLYYQESYEVPEIEEILDRPLLQIELRCV
TCIKKLSVAEKLEVVSNGERVHRVRNRLKAKCSLCRLYAI
140
Not Available
Not Available
01-01-1988
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response.
Not Available
GO:0003677  ;   GO:0006351  ;   GO:0006355  ;   GO:0030430  ;   GO:0039503  ;  
GO:0039526  ;   GO:0042025  ;   GO:0046872  
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available