viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA184R ACAM3000_MVA_184
Interleukin-1-binding protein (Protein B16)
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSILPVIFLSIFFYSSFVQTFNAPECIDKGQYFASFMELENEPVILPCPQINTLSSGYNILDILWEKRGADNDRIIPIDNGSNMLILNPTQSDSGIYICI
TTNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASNVNADIIWSGHRRLRNKRLKQRTPGIITIEDVRKNDAGYYTCVLEYIY
GGKTYNVTRIVKLEVRDKIIPSTMQLPEGVVTSIGSNLTIACRVSLRPPTTDADVFWISNGMYYEEDDGDGDGRISVANKIYMTDKRRVITSRLNINPVK
EEDATTFTCMAFTIPSISKTVTVSIT
326
Not Available
Not Available
01-06-1998
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Binds interleukin-1 and possibly interleukin-6. Could prevent these cytokines reaching their natural receptors. In consequence the inflammatory response would be diminished and virus replication enhanced.
Not Available
GO:0004908  ;   GO:0019012  ;   GO:0019048  ;   GO:0019966  ;   GO:0044228  
Virion. Host cell surface. Note=Or secretory glycoprotein.
♦DOMAIN 24 115 Ig-like 1.
♦ DOMAIN 122 212 Ig-like 2.
♦ DOMAIN 221 322 Ig-like 3.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available