Reviewed
Homo Sapiens (Human) [TaxID: 9606]
M[Gene ID: 1489822 ]
Matrix protein
Human Respiratory Syncytial Virus B (strain B1)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus B> Human Respiratory Syncytial Virus B (strain B1)
Not Available
Various pathway(s) in which protein is involved
Not Available
METYVNKLHEGSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSVPADLLIKELASINILVKQISTPKGPSLRVTINSRSAVLAQMPSNFIISANVSLDERS
KLAYDVTTPCEIKACSLTCLKVKSMLTTVKDLTMKTFNPTHEIIALCEFENIMTSKRVIIPTYLRPISVKNKDLNSLENIATTEFKNAITNAKIIPYAGL
VLVITVTDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFSIKPLED
KLAYDVTTPCEIKACSLTCLKVKSMLTTVKDLTMKTFNPTHEIIALCEFENIMTSKRVIIPTYLRPISVKNKDLNSLENIATTEFKNAITNAKIIPYAGL
VLVITVTDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFSIKPLED
256
Not Available
Not Available
01-01-1998
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Has a crucial role in virus assembly and budding. The matrix interacts with the RNP complex and this association serves two functions: facilitate virion assembly and inhibit the viral transcriptase activity. Early in infection, M is localized to the nucleus and may inhibit host cell transcription. Later on, M can associate with lipid rafts supposely by interacting with the cytoskeleton and with the cytoplasmic tail of glycoprotein G. The binding of M to host membrane is stabilized by the surface expression of the viral glycoproteins. These interactions may allow virus formation by mediating association of the nucleocapsid with the nascent envelope (By similarity).
Not Available
♦ Virion. Host cytoplasm. Host nucleus. Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=During bud formation, associates at the inner side of the plasma membrane of infected cells. .
♦ Peripheral membrane protein
♦ Cytoplasmic side . Note=During bud formation, associates at the inner side of the plasma membrane of infected cells. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available