Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Intermediate capsid protein VP6
Rotavirus A (strain RVA/Human/United States/P/1974/G3P1A[8]) (RV-A)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G3> Rotavirus A (strain RVA/Human/United States/P/1974/G3P1A[8]) (RV-A)
NC_011500.2 ; NC_011501.2 ; NC_011502.2 ; NC_011503.2 ; NC_011504.2 ; NC_011505.2 ; NC_011506.2 ;
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
Various pathway(s) in which protein is involved
Not Available
Not Available
MEVLYSLSKTLKNARDKIVEGTLYSNVSDLIQQFNQMIVTMNGNDFQTGGIGNLPIRNWTFDFGLLGTTLLNLDANYVETARTTIEYFIDFIDNVCMDEM
ARESQRNGVAPQSEALRKLAGIKFKRINFNNSSEYIENWNLQNRRQRTGFVFHKPNIFPYSASFTLNRSQPMHDNLMGTMWLNAGSEIQVAGFDYSCALN
APANIQQFEHIVQLRRALTTATITLLPDAERFSFPRVINSADGATTWFFNPIILRPNNVEVEFLLNGQIINTYQARFGTIIARNFDTIRLSFQLMRPPNM
TPAVNALFPQAQPFQHHATVGLTLRIESAVCESVLADANETLLANVTAVRQEYAIPVGPVFPPGMNWTELITNYSPSREDNLQRVFTVASIRSMLIK
ARESQRNGVAPQSEALRKLAGIKFKRINFNNSSEYIENWNLQNRRQRTGFVFHKPNIFPYSASFTLNRSQPMHDNLMGTMWLNAGSEIQVAGFDYSCALN
APANIQQFEHIVQLRRALTTATITLLPDAERFSFPRVINSADGATTWFFNPIILRPNNVEVEFLLNGQIINTYQARFGTIIARNFDTIRLSFQLMRPPNM
TPAVNALFPQAQPFQHHATVGLTLRIESAVCESVLADANETLLANVTAVRQEYAIPVGPVFPPGMNWTELITNYSPSREDNLQRVFTVASIRSMLIK
397
Not Available
Not Available
29-04-2008
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Intermediate capsid protein that self assembles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid remain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nascent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP.
Not Available
Virion . Note=Component of the intermediate capsid. Also found in spherical cytoplasmic structures, called virus factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available