Home Group Publications Resources Contact Us

Validation of Bhageerath

PDB ID	1YIB
Protein Name	Structure of Human EB1 C- Terminal Dimerization Domain
Sequence (FASTA format)	DDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATD
Secondary Structure Information	H 1-41, H 43-46, H 48-57
Native Structure	1yib

H - Helix, B - Beta strand

The figure shows the Superimposition of the native structure with the lowest RMSD structure (PDB5) from the 10 lowest energy structures (Native is shown in Blue and lowest RMSD structure is in Red)

Predicted Structures

S.No	Final 10 lowest energy structures	RMSD(Å) without end loops
1	PDB1	6.7
2	PDB2	5.3
3	PDB3	5.5
4	PDB4	5.8
5	PDB5	3.5
6	PDB6	4.8
7	PDB7	5.1
8	PDB8	4.5
9	PDB9	5.2
10	PDB10	4.6

	© Copyright 2004-2009, Prof B. Jayaram & Co-workers\| Disclaimer