|
Validation of Bhageerath |
PDB ID | 1EDM | Protein Name | Epidermal Growth Factor-like Domain from Human Factor IX | Sequence (FASTA format) | VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL | Secondary Structure Information | S 16-20, S 23-27 | Native Structure | 1edm |
H - Helix, B - Beta strand |
| The figure shows the Superimposition of the native structure with the lowest RMSD structure (PDB2) from the 10 lowest energy structures (Native is shown in Blue and lowest RMSD structure is in Red) |
|
|
|
© Copyright 2004-2009, Prof B. Jayaram & Co-workers| Disclaimer |
|
|
|